Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g072310.0.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 718aa    MW: 78653.3 Da    PI: 6.6208
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g072310.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++t++q++ Le++F+++++p+++ r +L++ lgL  rq+k+WFqNrR++ k
                        689*********************************************9987 PP

               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++el+++ + +ep+W+ks     + ++ d++ q+f+++++       ++ea+r sgvv+m+   lv  ++d++ +W e ++    k
                         67899**********************99***********99999*********************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlevis g      ++lqlm+ae q+lsplvp R  +f+R+++q + g+w+ivdvS d +q++   +s+ ++++lpSg+li++++ng+s
                         ***************************************************************998899********************** PP

               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kvtw+ehv+++++   h l+r l+ sg+a+ga +w+  lqr+ce+
                         **********998666***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.1672888IPR001356Homeobox domain
SMARTSM003892.1E-182992IPR001356Homeobox domain
CDDcd000861.26E-173089No hitNo description
PfamPF000462.8E-163586IPR001356Homeobox domain
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PROSITE profilePS5084848.053218456IPR002913START domain
SuperFamilySSF559611.24E-35219455No hitNo description
CDDcd088753.58E-112222452No hitNo description
SMARTSM002342.0E-43227453IPR002913START domain
PfamPF018528.4E-46228453IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-5233263IPR023393START-like domain
Gene3DG3DSA:3.30.530.204.4E-5336426IPR023393START-like domain
SuperFamilySSF559611.31E-20474683No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241474.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4C8V10.0K4C8V1_SOLLC; Uncharacterized protein
STRINGSolyc06g072310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11